PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g005326m
Common NameCISIN_1g005326mg, LOC102611258
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 703aa    MW: 77057.6 Da    PI: 5.4861
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g005326mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.82.2e-1003457013374
               GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        ++++++ e +++g+   aq +Larl+++ sp g+p+qR+a+yf+eAL+  l+   +      ++ + s ++ + +++a+k fse+sPil+f+
  orange1.1g005326m 345 DQIFKASELIETGNPVHAQGILARLNHQLSPIGKPFQRAAFYFKEALQLLLHM--NMN---NSSLALSGYSIIFKISAYKSFSEISPILQFA 431
                        78999**********************************************98..222...23344444569******************** PP

               GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                        ++t+Nqa+lea+eg++r+HiiDfdi++G+QW++L+q+L  R+egppsl+iT+++sp+++++ el+ t+e+L++fA+e+++pfe ++l   +l
  orange1.1g005326m 432 NFTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVLRSEGPPSLKITAFASPSTHDELELSFTRENLKHFASEINMPFELEIL---SL 520
                        **************************************************************************************9...66 PP

               GRAS 187 edleleeLrvkp....gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        e+l+  +L++       Ea+aVnl +   ++ + +++ +s    vL +vk+l+Pk+vv  ++ +d+++ +F +++++al+ ys l++sl+a 
  orange1.1g005326m 521 EALNSASLALPLrgleSEATAVNLPIG--TFCNYPATFPS----VLCFVKQLKPKIVVSLDRGCDRTDVPFPHHMIHALQSYSCLLESLDAV 606
                        6776666655544455*********95..55555777777....*********************************************665 PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                           + ++ +k+Er+l+ + i+++v  ++ +     e+l  W++ ++++GF p+++s+++++qa++l+++++++g++ve+++ sl l+W++++
  orange1.1g005326m 607 -NVNLDALQKIERFLVYPCIEKIVLGRHHS----PERLPPWKSLFMQSGFAPLTFSNFTESQADCLVQRTPVKGFHVEKRQSSLALCWQRKE 693
                        .3566999*****************99988....9********************************************************* PP

               GRAS 367 LvsvSaWr 374
                        L+ ++aWr
  orange1.1g005326m 694 LILATAWR 701
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.548317681IPR005202Transcription factor GRAS
PfamPF035147.4E-98345701IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MPLAFEDFQG KGALDFSSSP SDSVLLLRQQ LKPKPKQNWL LNNPNRGGST TEPTSVLDNR  60
TSPSTPASSS TLSSSLVGGG GGGSSTTDTT GVAAANVSSN PPSVEINTAE KCGGLGMEDW  120
ESVLSGSPNQ EQSILRLIMG DIDDPSLGIN KILPQDMEFN AGFGVVDQAN FGFETSFTCT  180
NSLLGSNIDP DFVGNNARLG SVSNQSHIFS TAAAANLLPP PSVFQQQPVE ALDEKPQILN  240
SQLVINQNQA QYTQNPALFL PLSYAQMQEH QLLSPALPPP KRLNLGPNQK VPFPDSGEQE  300
LFLRRQQLQM LQQQRETMGV TATATKQKLV NDELANQQLQ QAITDQIFKA SELIETGNPV  360
HAQGILARLN HQLSPIGKPF QRAAFYFKEA LQLLLHMNMN NSSLALSGYS IIFKISAYKS  420
FSEISPILQF ANFTCNQALL EAFEGCNRIH IIDFDIGYGG QWASLMQELV LRSEGPPSLK  480
ITAFASPSTH DELELSFTRE NLKHFASEIN MPFELEILSL EALNSASLAL PLRGLESEAT  540
AVNLPIGTFC NYPATFPSVL CFVKQLKPKI VVSLDRGCDR TDVPFPHHMI HALQSYSCLL  600
ESLDAVNVNL DALQKIERFL VYPCIEKIVL GRHHSPERLP PWKSLFMQSG FAPLTFSNFT  660
ESQADCLVQR TPVKGFHVEK RQSSLALCWQ RKELILATAW RC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-3035870118375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.120740.0callus
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ5059570.0GQ505957.1 Citrus trifoliata cultivar Zhi SCL6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445315.10.0hypothetical protein CICLE_v10019094mg
RefseqXP_006490865.10.0PREDICTED: scarecrow-like protein 27
RefseqXP_006490866.10.0PREDICTED: scarecrow-like protein 27
TrEMBLA0A067H1M90.0A0A067H1M9_CITSI; Uncharacterized protein
TrEMBLV4U3990.0V4U399_9R
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-147GRAS family protein